PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D13G1296
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 182aa    MW: 20961.4 Da    PI: 7.5
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D13G1296genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding23.11.7e-07944137
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-H CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtl 37
                     +g W+ +Ed++l+ +++++G  +W+  +  ++ gR +
      Gh_D13G1296  9 KGTWSRDEDQKLIAYITRYGIWNWNECPDFLQ-GRRR 44
                     799*****************99*********9.9976 PP

2Myb_DNA-binding35.62.1e-1148811146
                     HHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding 11 llvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
                     +l+++ k lG++ W+ Ia++++  Rt++++k++w++
      Gh_D13G1296 48 RLIHLQKTLGNR-WSVIAARLP-QRTDNDIKNYWNT 81
                     89**********.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.606.1E-9444IPR009057Homeodomain-like
SuperFamilySSF466893.1E-15779IPR009057Homeodomain-like
SMARTSM007174.8E-10885IPR001005SANT/Myb domain
CDDcd001671.10E-81183No hitNo description
PROSITE profilePS5129412.8233987IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.7E-154784IPR009057Homeodomain-like
PfamPF002491.3E-94881IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 182 aa     Download sequence    Send to blast
MVRQPYLTKG TWSRDEDQKL IAYITRYGIW NWNECPDFLQ GRRRNPNRLI HLQKTLGNRW  60
SVIAARLPQR TDNDIKNYWN TRLKKRINLE DNNSASATTS ATETNSGIEE KSSGADSSLL  120
FGNIMLDSPV YATFSTLGSN LSVASFLEQA RMIEGLDCEA MSQNSQLCHS HHQQYYDLLD  180
YF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-155883109B-MYB
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012461561.12e-98PREDICTED: transcription factor MYB23-like
TrEMBLA0A0D2VFB21e-133A0A0D2VFB2_G
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM3719122
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G15310.23e-20myb domain protein 16